PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010424-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 365aa    MW: 39983.7 Da    PI: 8.9185
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010424-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.9e-19186240256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tk+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  AHYPO_010424-RA 186 RKKLRLTKDQSAILEESFKEHNTLNPKQKMALAKRLGLRPRQVEVWFQNRRARTK 240
                      78889************************************************98 PP

2HD-ZIP_I/II128.82.3e-41186275191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  AHYPO_010424-RA 186 RKKLRLTKDQSAILEESFKEHNTLNPKQKMALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCEQLTEENRRLQKEVQELR-AL 275
                      69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.1E-194150IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.1E-19161243IPR009057Homeodomain-like
SuperFamilySSF466896.68E-19176243IPR009057Homeodomain-like
PROSITE profilePS5007117.605182242IPR001356Homeobox domain
SMARTSM003891.9E-16184246IPR001356Homeobox domain
CDDcd000864.79E-16186243No hitNo description
PfamPF000461.5E-16186240IPR001356Homeobox domain
PRINTSPR000313.0E-5213222IPR000047Helix-turn-helix motif
PROSITE patternPS000270217240IPR017970Homeobox, conserved site
PRINTSPR000313.0E-5222238IPR000047Helix-turn-helix motif
CDDcd146860.00354235274No hitNo description
SMARTSM003407.9E-27242285IPR003106Leucine zipper, homeobox-associated
PfamPF021836.5E-11242276IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMVMGKEDLG LSLSLGCSSN NNNNTTTGKN NLINNNNNPN FGFNIMLNSR NHLPTPQTTS  60
STASPLQLNL MMTPSLAASS AASPSPLLQK LPWNRSTDSF PPSSDRNSES CRSFLRGIDV  120
NRPAAGGDEE DVGVSSPNST VSTLSGKRSS GERDSTTTAA GGDEIEVERD SSRGLSDEED  180
GGENSRKKLR LTKDQSAILE ESFKEHNTLN PKQKMALAKR LGLRPRQVEV WFQNRRARTK  240
LKQTEVDCEF LKRCCEQLTE ENRRLQKEVQ ELRALKLSPQ FYMQMTPPTT LTMCPSCERV  300
AVPPSSTSAQ AQAQAQAQAQ AQAQAQTNPD PRATPTAHHR PMPVNPWVAA PVPIRTFDGR  360
HPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184190SRKKLRL
2234242RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677088.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like isoform X3
SwissprotP466011e-106HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A0J8CI360.0A0A0J8CI36_BETVU; Uncharacterized protein
STRINGVIT_00s0299g00100.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-99homeobox protein 2